Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48750] (1 PDB entry) |
Domain d1igtc1: 1igt C:1-108 [19766] Other proteins in same PDB: d1igta2, d1igtb2, d1igtb3, d1igtb4, d1igtc2, d1igtd2, d1igtd3, d1igtd4 |
PDB Entry: 1igt (more details), 2.8 Å
SCOP Domain Sequences for d1igtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igtc1 b.1.1.1 (C:1-108) Immunoglobulin (variable domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain} divltqspsslsaslgdtititchasqninvwlswyqqkpgnipklliykasnlhtgvps rfsgsgsgtgftltisslqpediatyycqqgqsypltfgggtkleikr
Timeline for d1igtc1: