SCOPe 2.06: Domain d1xgua1: 1xgu A:1-107

Lineage for d1xgua1 (1xgu A:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Escherichia coli [TaxId:562] [224853] (1 PDB entry)

8. Domain d1xgua1: 1xgu A:1-107 [197640]
   Other proteins in same PDB: d1xgua2, d1xguc_
   automated match to d1nbya1
   mutant

Details for d1xgua1

PDB Entry: 1xgu, 2.1 Å

PDB Description: Structure for antibody HyHEL-63 Y33F mutant complexed with hen egg lysozyme

PDB Compounds: (A:) antibody kappa light chain

SCOPe Domain Sequences for d1xgua1:

Sequence; same for both SEQRES and ATOM records:

>d1xgua1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Escherichia coli [TaxId: 562]}
divltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d1xgua1:

• d1xgua1 first appeared in SCOPe 2.03
  
• d1xgua1 appears in SCOPe 2.05
  
• d1xgua1 appears in SCOPe 2.07
  
• d1xgua1 appears in the current release, SCOPe 2.08