SCOPe 2.08: Domain d1dr9a1: 1dr9 A:1-105

Lineage for d1dr9a1 (1dr9 A:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD80, N-terminal domain [48745] (1 species)
   a soluble form of b7-1

7. Species Human (Homo sapiens) [TaxId:9606] [48746] (2 PDB entries)

8. Domain d1dr9a1: 1dr9 A:1-105 [19762]
   Other proteins in same PDB: d1dr9a2
   complexed with nag

Details for d1dr9a1

PDB Entry: 1dr9, 3 Å

PDB Description: crystal structure of a soluble form of b7-1 (cd80)

PDB Compounds: (A:) t lymphocyte activation antigen

SCOPe Domain Sequences for d1dr9a1:

Sequence; same for both SEQRES and ATOM records:

>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvk

Timeline for d1dr9a1:

• d1dr9a1 first appeared (with stable ids) in SCOP 1.55
  
• d1dr9a1 appears in SCOPe 2.07