Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries) |
Domain d1ci5a1: 1ci5 A:1-95 [19761] mutant |
PDB Entry: 1ci5 (more details)
SCOPe Domain Sequences for d1ci5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ci5a1 b.1.1.1 (A:1-95) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg sltiynltssdedeyemespnitdsmkfflyvges
Timeline for d1ci5a1: