Lineage for d1ci5a1 (1ci5 A:1-95)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103346Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species)
  7. 1103347Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries)
  8. 1103351Domain d1ci5a1: 1ci5 A:1-95 [19761]
    mutant

Details for d1ci5a1

PDB Entry: 1ci5 (more details)

PDB Description: glycan-free mutant adhesion domain of human cd58 (lfa-3)
PDB Compounds: (A:) protein (lymphocyte function-associated antigen 3(cd58))

SCOPe Domain Sequences for d1ci5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci5a1 b.1.1.1 (A:1-95) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ssqqiygvkygnvtfhvpsnqplkevlwkkqkdkvaelensefrafssfknrvyldtksg
sltiynltssdedeyemespnitdsmkfflyvges

SCOPe Domain Coordinates for d1ci5a1:

Click to download the PDB-style file with coordinates for d1ci5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ci5a1: