SCOPe 2.03: Domain d1vrnh2: 1vrn H:37-258

Lineage for d1vrnh2 (1vrn H:37-258)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [50349] (15 PDB entries)

8. Domain d1vrnh2: 1vrn H:37-258 [197588]
   Other proteins in same PDB: d1vrnc_, d1vrnh1, d1vrnl_, d1vrnm_
   automated match to d6prch1
   complexed with bcb, bpb, fe2, hem, lda, mq9, ns5, so4, uq7

Details for d1vrnh2

PDB Entry: 1vrn, 2.2 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1vrnh2:

Sequence; same for both SEQRES and ATOM records:

>d1vrnh2 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

Timeline for d1vrnh2:

• d1vrnh2 is new in SCOPe 2.03-stable
  
• d1vrnh2 appears in SCOPe 2.04
  
• d1vrnh2 appears in the current release, SCOPe 2.08