SCOPe 2.03: Domain d1uywn2: 1uyw N:108-211

Lineage for d1uywn2 (1uyw N:108-211)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d1uywn2: 1uyw N:108-211 [197582]
   Other proteins in same PDB: d1uywh1, d1uywl1, d1uywm1, d1uywn1
   automated match to d1kcul2

Details for d1uywn2

PDB Entry: 1uyw, 2 Å

PDB Description: crystal structure of the antiflavivirus fab4g2

PDB Compounds: (N:) fab antibody light chain

SCOPe Domain Sequences for d1uywn2:

Sequence; same for both SEQRES and ATOM records:

>d1uywn2 b.1.1.2 (N:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1uywn2:

• d1uywn2 is new in SCOPe 2.03-stable
  
• d1uywn2 appears in SCOPe 2.04
  
• d1uywn2 appears in the current release, SCOPe 2.08