![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries) |
![]() | Domain d1ccza1: 1ccz A:1-93 [19758] Other proteins in same PDB: d1ccza2 complexed with nag |
PDB Entry: 1ccz (more details), 1.8 Å
SCOPe Domain Sequences for d1ccza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} fsqqiygvvygnvtfhvpsnvplkevlwkkqkdkvaelensefrafssfknrvyldtvsg sltiynltssdedeyemespnitdtmkfflyvl
Timeline for d1ccza1: