Lineage for d1ccza1 (1ccz A:1-93)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352544Protein CD2-binding domain of CD58, N-terminal domain [48743] (1 species)
  7. 2352545Species Human (Homo sapiens) [TaxId:9606] [48744] (3 PDB entries)
  8. 2352546Domain d1ccza1: 1ccz A:1-93 [19758]
    Other proteins in same PDB: d1ccza2
    complexed with nag

Details for d1ccza1

PDB Entry: 1ccz (more details), 1.8 Å

PDB Description: crystal structure of the cd2-binding domain of cd58 (lymphocyte function-associated antigen 3) at 1.8-a resolution
PDB Compounds: (A:) protein (cd58)

SCOPe Domain Sequences for d1ccza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
fsqqiygvvygnvtfhvpsnvplkevlwkkqkdkvaelensefrafssfknrvyldtvsg
sltiynltssdedeyemespnitdtmkfflyvl

SCOPe Domain Coordinates for d1ccza1:

Click to download the PDB-style file with coordinates for d1ccza1.
(The format of our PDB-style files is described here.)

Timeline for d1ccza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ccza2