Lineage for d1uppe1 (1upp E:9-147)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909193Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1909194Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1909288Species Spinach (Spinacia oleracea) [TaxId:3562] [54970] (10 PDB entries)
  8. 1909339Domain d1uppe1: 1upp E:9-147 [197575]
    Other proteins in same PDB: d1uppa2, d1uppc2, d1uppe2, d1uppg2, d1uppi_, d1uppj_, d1uppk_, d1uppl_
    automated match to d8ruca2
    complexed with ca, cap

Details for d1uppe1

PDB Entry: 1upp (more details), 2.3 Å

PDB Description: spinach rubisco in complex with 2-carboxyarabinitol 2 bisphosphate and calcium.
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1uppe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uppe1 d.58.9.1 (E:9-147) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
asvefkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
alralrledlripvayvkt

SCOPe Domain Coordinates for d1uppe1:

Click to download the PDB-style file with coordinates for d1uppe1.
(The format of our PDB-style files is described here.)

Timeline for d1uppe1: