Lineage for d1a7bc_ (1a7b C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929364Protein CD2, first domain [48740] (2 species)
  7. 929371Species Norway rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)
  8. 929382Domain d1a7bc_: 1a7b C: [19756]
    misfolded V (N-terminal) domain dimer

Details for d1a7bc_

PDB Entry: 1a7b (more details), 3.1 Å

PDB Description: engineering a misfolded form of cd2
PDB Compounds: (C:) cd2

SCOPe Domain Sequences for d1a7bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7bc_ b.1.1.1 (C:) CD2, first domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tvwgalghginlnipnfqmtddidevrwergstlvaefkrkpflksgafeilangdlkik
nltrddsgtynvtvystngtrildkaldlrile

SCOPe Domain Coordinates for d1a7bc_:

Click to download the PDB-style file with coordinates for d1a7bc_.
(The format of our PDB-style files is described here.)

Timeline for d1a7bc_: