SCOPe 2.08: Domain d1u1ka2: 1u1k A:99-190

Lineage for d1u1ka2 (1u1k A:99-190)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
   Uniprot P09651 7-188

8. Domain d1u1ka2: 1u1k A:99-190 [197540]
   protein/DNA complex; protein/RNA complex

Details for d1u1ka2

PDB Entry: 1u1k, 2 Å

PDB Description: crystal structure of up1 complexed with d(ttagggtt 7da ggg); a human telomeric repeat containing 7-deaza-adenine

PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOPe Domain Sequences for d1u1ka2:

Sequence; same for both SEQRES and ATOM records:

>d1u1ka2 d.58.7.1 (A:99-190) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
gahltvkkifvggikedteehhlrdyfeqygkievieimtdrgsgkkrgfafvtfddhds
vdkiviqkyhtvnghncevrkalskqemasas

Timeline for d1u1ka2:

• d1u1ka2 first appeared in SCOPe 2.03
  
• d1u1ka2 appears in SCOPe 2.07