SCOPe 2.07: Domain d1hngb1: 1hng B:2-99

Lineage for d1hngb1 (1hng B:2-99)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)

8. Domain d1hngb1: 1hng B:2-99 [19753]
   Other proteins in same PDB: d1hnga2, d1hngb2

Details for d1hngb1

PDB Entry: 1hng, 2.8 Å

PDB Description: crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2

PDB Compounds: (B:) cd2

SCOPe Domain Sequences for d1hngb1:

Sequence; same for both SEQRES and ATOM records:

>d1hngb1 b.1.1.1 (B:2-99) CD2, first domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilang
dlkiknltrddsgtynvtvystngtrilnkaldlrile

Timeline for d1hngb1:

• d1hngb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hngb1 appears in SCOPe 2.06
  
• d1hngb1 appears in the current release, SCOPe 2.08