Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
Domain d1t2ql1: 1t2q L:2-114 [197521] Other proteins in same PDB: d1t2qh1, d1t2ql2 automated match to d2jell1 complexed with gol, mes |
PDB Entry: 1t2q (more details), 1.83 Å
SCOPe Domain Sequences for d1t2ql1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2ql1 b.1.1.1 (L:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]} elvmtqsplslpvslgdqasiscrssqslvhssgntylhwylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftltisrveaedlgvyycfqgshvpltfgagtklelkr
Timeline for d1t2ql1: