![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily) multihelical; 8 helices arranged in 2 parallel layers |
![]() | Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) ![]() duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site |
![]() | Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein) |
![]() | Protein GroEL, E domain [48594] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [48595] (11 PDB entries) |
![]() | Domain d1svtk1: 1svt K:2-136,K:410-525 [197505] Other proteins in same PDB: d1svta2, d1svta3, d1svtb2, d1svtb3, d1svtc2, d1svtc3, d1svtd2, d1svtd3, d1svte2, d1svte3, d1svtf2, d1svtf3, d1svtg2, d1svtg3, d1svth2, d1svth3, d1svti2, d1svti3, d1svtj2, d1svtj3, d1svtk2, d1svtk3, d1svtl2, d1svtl3, d1svtm2, d1svtm3, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_ automated match to d1pcqa1 complexed with adp, af3, k, mg |
PDB Entry: 1svt (more details), 2.81 Å
SCOPe Domain Sequences for d1svtk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svtk1 a.129.1.1 (K:2-136,K:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]} aakdvkfgndarvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid kavtaaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl mittecmvtdlp
Timeline for d1svtk1:
![]() Domains from other chains: (mouse over for more information) d1svta1, d1svta2, d1svta3, d1svtb1, d1svtb2, d1svtb3, d1svtc1, d1svtc2, d1svtc3, d1svtd1, d1svtd2, d1svtd3, d1svte1, d1svte2, d1svte3, d1svtf1, d1svtf2, d1svtf3, d1svtg1, d1svtg2, d1svtg3, d1svth1, d1svth2, d1svth3, d1svti1, d1svti2, d1svti3, d1svtj1, d1svtj2, d1svtj3, d1svtl1, d1svtl2, d1svtl3, d1svtm1, d1svtm2, d1svtm3, d1svtn1, d1svtn2, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_ |