Lineage for d1svtj2 (1svt J:137-190,J:367-409)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. Protein GroEL, I domain [54851] (4 species)
  7. Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)
  8. Domain d1svtj2: 1svt J:137-190,J:367-409 [197503]
    Other proteins in same PDB: d1svta1, d1svta3, d1svtb1, d1svtb3, d1svtc1, d1svtc3, d1svtd1, d1svtd3, d1svte1, d1svte3, d1svtf1, d1svtf3, d1svtg1, d1svtg3, d1svth1, d1svth3, d1svti1, d1svti3, d1svtj1, d1svtj3, d1svtk1, d1svtk3, d1svtl1, d1svtl3, d1svtm1, d1svtm3, d1svtn1, d1svtn3, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_
    automated match to d1pcqa3
    complexed with adp, af3, k, mg

Details for d1svtj2

PDB Entry: 1svt (more details), 2.8099999999999996 Å

PDB Description: crystal structure of groel14-groes7-(adp-alfx)7
PDB Compounds: (J:) groEL protein

SCOPe Domain Sequences for d1svtj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svtj2 d.56.1.1 (J:137-190,J:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1svtj2 are not available.

Timeline for d1svtj2: