SCOPe 2.06: Domain d1svtf3: 1svt F:191-366

Lineage for d1svtf3 (1svt F:191-366)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
this domain is thought to be mobile in most multi-domain proteins known to contain it

Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
Protein GroEL, A domain [52031] (4 species)
Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)

Domain d1svtf3: 1svt F:191-366 [197492]
Other proteins in same PDB: d1svta1, d1svta2, d1svtb1, d1svtb2, d1svtc1, d1svtc2, d1svtd1, d1svtd2, d1svte1, d1svte2, d1svtf1, d1svtf2, d1svtg1, d1svtg2, d1svth1, d1svth2, d1svti1, d1svti2, d1svtj1, d1svtj2, d1svtk1, d1svtk2, d1svtl1, d1svtl2, d1svtm1, d1svtm2, d1svtn1, d1svtn2, d1svto_, d1svtp_, d1svtq_, d1svtr_, d1svts_, d1svtt_, d1svtu_
automated match to d1pcqa2
complexed with adp, af3, k, mg

Details for d1svtf3

PDB Entry: 1svt (more details), 2.81 Å

PDB Description: crystal structure of groel14-groes7-(adp-alfx)7

PDB Compounds: (F:) groEL protein

SCOPe Domain Sequences for d1svtf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svtf3 c.8.5.1 (F:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1svtf3:

Click to download the PDB-style file with coordinates for d1svtf3.
(The format of our PDB-style files is described here.)

Timeline for d1svtf3: