Lineage for d1sqxe1 (1sqx E:1-69)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958070Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 1958071Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1958072Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 1958088Species Cow (Bos taurus) [TaxId:9913] [81497] (17 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 1958099Domain d1sqxe1: 1sqx E:1-69 [197473]
    Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
    automated match to d1ntme2
    complexed with fes, hem, sma, uq2

Details for d1sqxe1

PDB Entry: 1sqx (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A
PDB Compounds: (E:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1sqxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqxe1 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1sqxe1:

Click to download the PDB-style file with coordinates for d1sqxe1.
(The format of our PDB-style files is described here.)

Timeline for d1sqxe1: