SCOPe 2.04: Domain d1sqxe1: 1sqx E:1-69

Lineage for d1sqxe1 (1sqx E:1-69)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (17 PDB entries)
   Uniprot P13272; precursor of chains I,E and V,R

8. Domain d1sqxe1: 1sqx E:1-69 [197473]
   Other proteins in same PDB: d1sqxa1, d1sqxa2, d1sqxb1, d1sqxb2, d1sqxc1, d1sqxc2, d1sqxd1, d1sqxd2, d1sqxe2, d1sqxf_, d1sqxg_, d1sqxh_, d1sqxi_, d1sqxj_, d1sqxk_
   automated match to d1ntme2
   complexed with fes, hem, sma, uq2

Details for d1sqxe1

PDB Entry: 1sqx, 2.6 Å

PDB Description: crystal structure analysis of bovine bc1 with stigmatellin a

PDB Compounds: (E:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1sqxe1:

Sequence; same for both SEQRES and ATOM records:

>d1sqxe1 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d1sqxe1:

• d1sqxe1 first appeared in SCOPe 2.03
  
• d1sqxe1 appears in SCOPe 2.05
  
• d1sqxe1 appears in the current release, SCOPe 2.08