Class b: All beta proteins [48724] (176 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50025] (18 PDB entries) |
Domain d1sqve2: 1sqv E:70-196 [197472] Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve1, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi_, d1sqvj_, d1sqvk_ automated match to d1ntme1 complexed with fes, hem, uhd, uq2 |
PDB Entry: 1sqv (more details), 2.85 Å
SCOPe Domain Sequences for d1sqve2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqve2 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d1sqve2: