Lineage for d1sqve1 (1sqv E:1-69)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631229Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2631230Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 2631231Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)
  7. 2631247Species Cow (Bos taurus) [TaxId:9913] [81497] (19 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 2631261Domain d1sqve1: 1sqv E:1-69 [197471]
    Other proteins in same PDB: d1sqva1, d1sqva2, d1sqvb1, d1sqvb2, d1sqvc1, d1sqvc2, d1sqvd1, d1sqvd2, d1sqve2, d1sqvf_, d1sqvg_, d1sqvh_, d1sqvi_, d1sqvj_, d1sqvk_
    automated match to d1ntme2
    complexed with fes, hem, uhd, uq2

Details for d1sqve1

PDB Entry: 1sqv (more details), 2.85 Å

PDB Description: crystal structure analysis of bovine bc1 with uhdbt
PDB Compounds: (E:) ubiquinol-cytochrome c reductase iron-sulfur subunit

SCOPe Domain Sequences for d1sqve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqve1 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1sqve1:

Click to download the PDB-style file with coordinates for d1sqve1.
(The format of our PDB-style files is described here.)

Timeline for d1sqve1: