![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50025] (18 PDB entries) |
![]() | Domain d1sqpe2: 1sqp E:70-196 [197470] Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1 automated match to d1ntme1 complexed with cdl, fes, hem, myx, pee, plx |
PDB Entry: 1sqp (more details), 2.7 Å
SCOPe Domain Sequences for d1sqpe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqpe2 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d1sqpe2: