Lineage for d1sqpe2 (1sqp E:70-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782357Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (4 species)
  7. 2782376Species Cow (Bos taurus) [TaxId:9913] [50025] (20 PDB entries)
  8. 2782391Domain d1sqpe2: 1sqp E:70-196 [197470]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
    automated match to d1ntme1
    complexed with cdl, fes, hec, myx, pee, plx

Details for d1sqpe2

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqpe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpe2 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d1sqpe2:

Click to download the PDB-style file with coordinates for d1sqpe2.
(The format of our PDB-style files is described here.)

Timeline for d1sqpe2: