SCOPe 2.04: Domain d1sqpe1: 1sqp E:1-69

Lineage for d1sqpe1 (1sqp E:1-69)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (17 PDB entries)
   Uniprot P13272; precursor of chains I,E and V,R

8. Domain d1sqpe1: 1sqp E:1-69 [197469]
   Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
   automated match to d1ntme2
   complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpe1

PDB Entry: 1sqp, 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol

PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)]

SCOPe Domain Sequences for d1sqpe1:

Sequence; same for both SEQRES and ATOM records:

>d1sqpe1 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d1sqpe1:

• d1sqpe1 first appeared in SCOPe 2.03
  
• d1sqpe1 appears in SCOPe 2.05
  
• d1sqpe1 appears in the current release, SCOPe 2.08