Lineage for d3v3ra_ (3v3r A:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1233516Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1233517Protein automated matches [190857] (6 species)
    not a true protein
  7. 1233518Species Acinetobacter baumannii [TaxId:470] [194613] (2 PDB entries)
  8. 1233521Domain d3v3ra_: 3v3r A: [197447]
    automated match to d3ni9a_
    complexed with iod, na

Details for d3v3ra_

PDB Entry: 3v3r (more details), 1.9 Å

PDB Description: Crystal Structure of GES-11
PDB Compounds: (A:) Extended spectrum class A beta-lactamase GES-11

SCOPe Domain Sequences for d3v3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v3ra_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
gpaamtqyfrkigdsvsrldrkepemgdntpgdlrdtttpiamartvakvlyggaltsts
thtierwlignqtgdatlragfpkdwvvgektgtcangarndigffkaqerdyavavytt
apklsaverdelvasvgqvitqlils

SCOPe Domain Coordinates for d3v3ra_:

Click to download the PDB-style file with coordinates for d3v3ra_.
(The format of our PDB-style files is described here.)

Timeline for d3v3ra_: