Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (40 species) not a true protein |
Species Lycopersicon hirsutum [TaxId:283673] [195413] (6 PDB entries) |
Domain d3stxb_: 3stx B: [197444] automated match to d3gzja_ complexed with bka |
PDB Entry: 3stx (more details), 2.3 Å
SCOPe Domain Sequences for d3stxb_:
Sequence, based on SEQRES records: (download)
>d3stxb_ c.69.1.0 (B:) automated matches {Lycopersicon hirsutum [TaxId: 283673]} spfvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdyl splmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvc tkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplyl ylaediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkeiegsdavt mmskpqqlfttllsiankyk
>d3stxb_ c.69.1.0 (B:) automated matches {Lycopersicon hirsutum [TaxId: 283673]} spfvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdyl splmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvc tkagsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplyl ylaediskevvlsskrygsvkrvfivatenkkeflklmieknppdevkeiegsdavtmms kpqqlfttllsiankyk
Timeline for d3stxb_: