Lineage for d1cdb__ (1cdb -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein CD2, first domain [48740] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries) 
Domain d1cdb__: 1cdb - [19744]
Details for d1cdb__
PDB Entry: 1cdb (more details)
PDB Description: structure of the glycosylated adhesion domain of human t lymphocyte glycoprotein cd2
SCOP Domain Sequences for d1cdb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdb__ b.1.1.1 (-) CD2, first domain {Human (Homo sapiens)}
keitnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdty
klfkngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqer
SCOP Domain Coordinates for d1cdb__:
Click to download the PDB-style file with coordinates for d1cdb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cdb__:
- d1cdb__ first appeared (with stable ids) in SCOP 1.55
- d1cdb__ appears in SCOP 1.59
- d1cdb__ appears in the current release, SCOPe 2.08, called d1cdba_
View in 3D