Lineage for d3p9wf_ (3p9w F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290033Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)
  8. 1290146Domain d3p9wf_: 3p9w F: [197427]
    Other proteins in same PDB: d3p9wa_, d3p9wc_, d3p9we_, d3p9wg_
    automated match to d3b9vd_

Details for d3p9wf_

PDB Entry: 3p9w (more details), 2.41 Å

PDB Description: Crystal structure of an engineered human autonomous VH Domain in complex with VEGF
PDB Compounds: (F:) human VEGF

SCOPe Domain Sequences for d3p9wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9wf_ b.1.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfnikdtyigwvrrapgkgeelvariyptngytrya
dsvkgrftisadtskntaylqmnslraedtavyycyyhyygwhpgyglsyssgqgtlvtv
ss

SCOPe Domain Coordinates for d3p9wf_:

Click to download the PDB-style file with coordinates for d3p9wf_.
(The format of our PDB-style files is described here.)

Timeline for d3p9wf_: