SCOPe 2.06: Domain d4l2mb_: 4l2m B:

Lineage for d4l2mb_ (4l2m B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein automated matches [190322] (4 species)
   not a true protein

7. Species Synechococcus sp. [TaxId:32049] [194261] (4 PDB entries)

8. Domain d4l2mb_: 4l2m B: [197421]
   automated match to d4i0vb_
   complexed with cyn, heb, so4

Details for d4l2mb_

PDB Entry: 4l2m, 2.25 Å

PDB Description: Crystal structure of the 2/2 hemoglobin from Synechococcus sp. PCC 7002 in the cyanomet state and with covalently attached heme

PDB Compounds: (B:) Cyanoglobin

SCOPe Domain Sequences for d4l2mb_:

Sequence; same for both SEQRES and ATOM records:

>d4l2mb_ a.1.1.1 (B:) automated matches {Synechococcus sp. [TaxId: 32049]}
aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
lnr

Timeline for d4l2mb_:

• d4l2mb_ first appeared in SCOPe 2.02
  
• d4l2mb_ appears in SCOPe 2.05
  
• d4l2mb_ appears in SCOPe 2.07
  
• d4l2mb_ appears in the current release, SCOPe 2.08