Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins) |
Protein CD2, first domain [48740] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries) |
Domain d1hnf_1: 1hnf 4-104 [19741] Other proteins in same PDB: d1hnf_2 complexed with na, nag |
PDB Entry: 1hnf (more details), 2.5 Å
SCOP Domain Sequences for d1hnf_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnf_1 b.1.1.1 (4-104) CD2, first domain {Human (Homo sapiens)} tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyklf kngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqe
Timeline for d1hnf_1: