Lineage for d1hnf_1 (1hnf 4-104)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287136Protein CD2, first domain [48740] (2 species)
  7. 287137Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)
  8. 287138Domain d1hnf_1: 1hnf 4-104 [19741]
    Other proteins in same PDB: d1hnf_2
    complexed with na, nag

Details for d1hnf_1

PDB Entry: 1hnf (more details), 2.5 Å

PDB Description: crystal structure of the extracellular region of the human cell adhesion molecule cd2 at 2.5 angstroms resolution

SCOP Domain Sequences for d1hnf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnf_1 b.1.1.1 (4-104) CD2, first domain {Human (Homo sapiens)}
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyklf
kngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqe

SCOP Domain Coordinates for d1hnf_1:

Click to download the PDB-style file with coordinates for d1hnf_1.
(The format of our PDB-style files is described here.)

Timeline for d1hnf_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnf_2