SCOPe 2.08: Domain d1hnfa1: 1hnf A:4-104

Lineage for d1hnfa1 (1hnf A:4-104)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD2, first domain [48740] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48741] (4 PDB entries)

8. Domain d1hnfa1: 1hnf A:4-104 [19741]
   Other proteins in same PDB: d1hnfa2
   complexed with na, nag

Details for d1hnfa1

PDB Entry: 1hnf, 2.5 Å

PDB Description: crystal structure of the extracellular region of the human cell adhesion molecule cd2 at 2.5 angstroms resolution

PDB Compounds: (A:) cd2

SCOPe Domain Sequences for d1hnfa1:

Sequence; same for both SEQRES and ATOM records:

>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]}
tnaletwgalgqdinldipsfqmsddiddikwektsdkkkiaqfrkeketfkekdtyklf
kngtlkikhlktddqdiykvsiydtkgknvlekifdlkiqe

Timeline for d1hnfa1:

• d1hnfa1 first appeared (with stable ids) in SCOP 1.55, called d1hnf_1
  
• d1hnfa1 appears in SCOPe 2.07