SCOP 1.75: Domain d1cida1: 1cid A:1-105

Lineage for d1cida1 (1cid A:1-105)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [48739] (1 PDB entry)

8. Domain d1cida1: 1cid A:1-105 [19740]
   Other proteins in same PDB: d1cida2
   domain 3
   complexed with so4

Details for d1cida1

PDB Entry: 1cid, 2.8 Å

PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains

PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOP Domain Sequences for d1cida1:

Sequence; same for both SEQRES and ATOM records:

>d1cida1 b.1.1.1 (A:1-105) CD4 V-set domains {Rat (Rattus rattus) [TaxId: 10117]}
tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts
npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlv

Timeline for d1cida1:

• d1cida1 first appeared (with stable ids) in SCOP 1.55, called d1cid_1
  
• d1cida1 appears in SCOP 1.73
  
• d1cida1 appears in SCOPe 2.01
  
• d1cida1 appears in the current release, SCOPe 2.07