SCOP 1.61: Domain d1cid_1: 1cid 1-105

Lineage for d1cid_1 (1cid 1-105)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein N-terminal domain of CD4 [48737] (2 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [48739] (1 PDB entry)

8. Domain d1cid_1: 1cid 1-105 [19740]
   Other proteins in same PDB: d1cid_2

Details for d1cid_1

PDB Entry: 1cid, 2.8 Å

PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains

SCOP Domain Sequences for d1cid_1:

Sequence; same for both SEQRES and ATOM records:

>d1cid_1 b.1.1.1 (1-105) N-terminal domain of CD4 {Rat (Rattus rattus)}
tsitayksegesaefsfplnlgeeslqgelrwkaekapssqswitfslknqkvsvqksts
npkfqlsetlpltlqipqvslqfagsgnltltldrgilyqevnlv

Timeline for d1cid_1:

• d1cid_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cid_1 appears in SCOP 1.59
  
• d1cid_1 appears in SCOP 1.63
  
• d1cid_1 appears in the current release, SCOPe 2.08, called d1cida1