SCOPe 2.02: Domain d4giha_: 4gih A:

Lineage for d4giha_ (4gih A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (54 PDB entries)

8. Domain d4giha_: 4gih A: [197387]
   automated match to d3nz0a_
   complexed with 0x5

Details for d4giha_

PDB Entry: 4gih, 2 Å

PDB Description: tyk2 (jh1) in complex with 2,6-dichloro-n-{2-[(cyclopropylcarbonyl) amino]pyridin-4-yl}benzamide

PDB Compounds: (A:) Non-receptor tyrosine-protein kinase TYK2

SCOPe Domain Sequences for d4giha_:

Sequence; same for both SEQRES and ATOM records:

>d4giha_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfhkrylkkirdlgeghfgkvslycydptndgtgemvavkalkadagpqhrsgwkqeid
ilrtlyhehiikykgccedagaaslqlvmeyvplgslrdylprhsiglaqlllfaqqice
gmaylhaqhyihrnlaarnvlldndrlvkigdfglakavpegheyyrvredgdspvfwya
peclkeykfyyasdvwsfgvtlyellthcdssqspptkfleligiaqgqmtvlrltelle
rgerlprpdkcpaevyhlmkncweteasfrptfenlipilktvhekyr

Timeline for d4giha_:

• d4giha_ is new in SCOPe 2.02-stable
  
• d4giha_ appears in SCOPe 2.03
  
• d4giha_ appears in the current release, SCOPe 2.08, called d4giha1