Lineage for d1wiqa2 (1wiq A:179-291)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 103180Protein N-terminal domain of CD4 [48737] (2 species)
  7. 103181Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)
  8. 103201Domain d1wiqa2: 1wiq A:179-291 [19737]
    Other proteins in same PDB: d1wiqa3, d1wiqa4, d1wiqb3, d1wiqb4

Details for d1wiqa2

PDB Entry: 1wiq (more details), 5 Å

PDB Description: structure of t-cell surface glycoprotein cd4, trigonal crystal form

SCOP Domain Sequences for d1wiqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiqa2 b.1.1.1 (A:179-291) N-terminal domain of CD4 {Human (Homo sapiens)}
fqkassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsv
krvtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvv

SCOP Domain Coordinates for d1wiqa2:

Click to download the PDB-style file with coordinates for d1wiqa2.
(The format of our PDB-style files is described here.)

Timeline for d1wiqa2: