Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (50 species) not a true protein |
Species Legionella pneumophila [TaxId:297246] [197273] (1 PDB entry) |
Domain d4kunb_: 4kun B: [197340] automated match to d2qkea_ |
PDB Entry: 4kun (more details), 1.95 Å
SCOPe Domain Sequences for d4kunb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kunb_ c.47.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 297246]} mtrtklklfvignsaiskraiinlqsicsdpkladlcdievvdlcknkgiaeqekilatp ilikkeplperriigdlsdkqkvisalemd
Timeline for d4kunb_: