Lineage for d4jvua_ (4jvu A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1296777Domain d4jvua_: 4jvu A: [197334]
    automated match to d1g84a_

Details for d4jvua_

PDB Entry: 4jvu (more details), 1.3 Å

PDB Description: IgM C2-domain from mouse
PDB Compounds: (A:) Ig mu chain C region membrane-bound form

SCOPe Domain Sequences for d4jvua_:

Sequence, based on SEQRES records: (download)

>d4jvua_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgft
tdpvtienkgstpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstc

Sequence, based on observed residues (ATOM records): (download)

>d4jvua_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgft
tdpvtietpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstc

SCOPe Domain Coordinates for d4jvua_:

Click to download the PDB-style file with coordinates for d4jvua_.
(The format of our PDB-style files is described here.)

Timeline for d4jvua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4jvub_