Lineage for d4jvua_ (4jvu A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1109749Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1109750Protein automated matches [190740] (5 species)
    not a true protein
  7. 1109775Species Mouse (Mus musculus) [TaxId:10090] [188198] (2 PDB entries)
  8. 1109776Domain d4jvua_: 4jvu A: [197334]
    automated match to d1g84a_

Details for d4jvua_

PDB Entry: 4jvu (more details), 1.3 Å

PDB Description: IgM C2-domain from mouse
PDB Compounds: (A:) Ig mu chain C region membrane-bound form

SCOPe Domain Sequences for d4jvua_:

Sequence, based on SEQRES records: (download)

>d4jvua_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgft
tdpvtienkgstpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstc

Sequence, based on observed residues (ATOM records): (download)

>d4jvua_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gipavaemnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgft
tdpvtietpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstc

SCOPe Domain Coordinates for d4jvua_:

Click to download the PDB-style file with coordinates for d4jvua_.
(The format of our PDB-style files is described here.)

Timeline for d4jvua_:

  • d4jvua_ appears in periodic updates to SCOPe 2.02 starting on 2013-06-13
  • d4jvua_ appears in SCOPe 2.03
  • d4jvua_ appears in the current release, SCOPe 2.07, called d4jvua1