SCOPe 2.08: Domain d4hx5b1: 4hx5 B:24-283

Lineage for d4hx5b1 (4hx5 B:24-283)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
   Uniprot P28845

8. Domain d4hx5b1: 4hx5 B:24-283 [197314]
   Other proteins in same PDB: d4hx5b2, d4hx5c2, d4hx5d2
   automated match to d3pdjb_
   complexed with 19v, ndp

Details for d4hx5b1

PDB Entry: 4hx5, 2.19 Å

PDB Description: Crystal structure of 11 beta-HSD1 in complex with SAR184841

PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d4hx5b1:

Sequence; same for both SEQRES and ATOM records:

>d4hx5b1 c.2.1.2 (B:24-283) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslw
ttllirnpsrkileflysts

Timeline for d4hx5b1:

• d4hx5b1 first appeared in SCOPe 2.02, called d4hx5b_
  
• d4hx5b1 appears in SCOPe 2.07