SCOPe 2.02: Domain d4hapb_: 4hap B:

Lineage for d4hapb_ (4hap B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold

6. Protein automated matches [190170] (6 species)
   not a true protein

7. Species Limnoria quadripunctata [TaxId:161573] [197311] (1 PDB entry)

8. Domain d4hapb_: 4hap B: [197312]
   automated match to d2xspa_
   complexed with ca, cbi, trs

Details for d4hapb_

PDB Entry: 4hap, 1.6 Å

PDB Description: crystal structure of a gh7 family cellobiohydrolase from limnoria quadripunctata in complex with cellobiose

PDB Compounds: (B:) GH7 family protein

SCOPe Domain Sequences for d4hapb_:

Sequence; same for both SEQRES and ATOM records:

>d4hapb_ b.29.1.10 (B:) automated matches {Limnoria quadripunctata [TaxId: 161573]}
eqagteteeyhlpltwerdgssvsasvvidsnwrwthstedttncydgnewdstlcpdad
tctencaidgvdqgtwgdtygitasgskltlsfvtegeystdigsrvflmadddnyeifn
lldkefsfdvdasnlpcglngalyfvsmdedggtskystntagakygtgycdaqcphdmk
fiagkansdgwtpsdndqnagtgemgacchemdiweansqaqsytahvcsvdgytpctgt
dcgdngddrykgvcdkdgcdyaayrlgqhdfygeggtvdsgstltvitqfitgggglnei
rriyqqggqtiqnaavnfpgdvdpydsitedfcvdikryfgdtndfdakggmsgmsnalk
kgmvlvmslwddhyanmlwldatypvdstepgalrgpcstdsgdpadveanfpgstvtfs
nikigpiqsyd

Timeline for d4hapb_:

• d4hapb_ is new in SCOPe 2.02-stable
  
• d4hapb_ appears in SCOPe 2.03
  
• d4hapb_ appears in the current release, SCOPe 2.08, called d4hapb1