Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries) |
Domain d1wiob2: 1wio B:179-291 [19731] Other proteins in same PDB: d1wioa3, d1wioa4, d1wiob3, d1wiob4 domains 1 and 3 |
PDB Entry: 1wio (more details), 3.9 Å
SCOP Domain Sequences for d1wiob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiob2 b.1.1.1 (B:179-291) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} fqkassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsv krvtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvv
Timeline for d1wiob2:
View in 3D Domains from other chains: (mouse over for more information) d1wioa1, d1wioa2, d1wioa3, d1wioa4 |