Lineage for d4fh8c_ (4fh8 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169030Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1169352Protein automated matches [190100] (10 species)
    not a true protein
  7. 1169445Species Ancylostoma ceylanicum [TaxId:53326] [197299] (1 PDB entry)
  8. 1169448Domain d4fh8c_: 4fh8 C: [197302]
    automated match to d1qmva_

Details for d4fh8c_

PDB Entry: 4fh8 (more details), 2.11 Å

PDB Description: Crystal Structure of Peroxiredoxin-1 from the human hookworm Ancylostoma ceylanicum
PDB Compounds: (C:) AcePrx-1

SCOPe Domain Sequences for d4fh8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fh8c_ c.47.1.10 (C:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]}
mskafigkpapdfatkavfdgdfvdvklsdykgkyvvlffypldftfvcpteiiafsdrf
pefknlnvavlacstdsvfshlawintprkhgglgdmkipvladtnhqiakdygvlkdde
giayrglfiidpkgilrqitindlpvgrsvdetlrlvqafqytdkhge

SCOPe Domain Coordinates for d4fh8c_:

Click to download the PDB-style file with coordinates for d4fh8c_.
(The format of our PDB-style files is described here.)

Timeline for d4fh8c_: