Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein N-terminal domain of CD4 [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries) |
Domain d1wiob1: 1wio B:1-97 [19730] Other proteins in same PDB: d1wioa3, d1wioa4, d1wiob3, d1wiob4 |
PDB Entry: 1wio (more details), 3.9 Å
SCOP Domain Sequences for d1wiob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiob1 b.1.1.1 (B:1-97) N-terminal domain of CD4 {Human (Homo sapiens)} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1wiob1:
View in 3D Domains from other chains: (mouse over for more information) d1wioa1, d1wioa2, d1wioa3, d1wioa4 |