SCOPe 2.08: Domain d4fdxa_: 4fdx A:

Lineage for d4fdxa_ (4fdx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Methylibium petroleiphilum [TaxId:420662] [197231] (2 PDB entries)

8. Domain d4fdxa_: 4fdx A: [197298]
   automated match to d4otba_

Details for d4fdxa_

PDB Entry: 4fdx, 1.64 Å

PDB Description: Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from Methylibium petroleiphilum

PDB Compounds: (A:) 4-oxalocrotonase tautomerase isozyme

SCOPe Domain Sequences for d4fdxa_:

Sequence; same for both SEQRES and ATOM records:

>d4fdxa_ d.80.1.0 (A:) automated matches {Methylibium petroleiphilum [TaxId: 420662]}
piiqmnllegrtveqkrnavaaiteavvrtldvrpdqvrilinelgvehfsvagqtaamr
q

Timeline for d4fdxa_:

• d4fdxa_ first appeared in SCOPe 2.02
  
• d4fdxa_ appears in SCOPe 2.07