Lineage for d4e91a_ (4e91 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717867Domain d4e91a_: 4e91 A: [197294]
    automated match to d1afva_
    complexed with 0oe, 0of, iod

Details for d4e91a_

PDB Entry: 4e91 (more details), 1.7 Å

PDB Description: Crystal Structure of the N-Terminal Domain of HIV-1 Capsid in Complex With Inhibitor BD3
PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d4e91a_:

Sequence, based on SEQRES records: (download)

>d4e91a_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Sequence, based on observed residues (ATOM records): (download)

>d4e91a_ a.73.1.1 (A:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaam
qmlketineeaaewdrlhpvmreprgsdiagttstlqeqigwmthnppipvgeiykrwii
lglnkivrmys

SCOPe Domain Coordinates for d4e91a_:

Click to download the PDB-style file with coordinates for d4e91a_.
(The format of our PDB-style files is described here.)

Timeline for d4e91a_: