Lineage for d4b15a_ (4b15 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146973Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1146974Protein automated matches [190075] (30 species)
    not a true protein
  7. 1147073Species Tamarindus indica [TaxId:58860] [197290] (2 PDB entries)
  8. 1147074Domain d4b15a_: 4b15 A: [197292]
    automated match to d1kqza_
    complexed with act, mpd, na

Details for d4b15a_

PDB Entry: 4b15 (more details), 1.49 Å

PDB Description: crystal structure of tamarind chitinase like lectin (tcll)
PDB Compounds: (A:) chitinase like lectin

SCOPe Domain Sequences for d4b15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b15a_ c.1.8.0 (A:) automated matches {Tamarindus indica [TaxId: 58860]}
ggnivvywgqggsdnsegslkeacksghynmivleelitydngrdpdlnlgahcvnctsl
qqeikycqlklikillqigqvtptkedtkdttkdlsqyldsnffsgksgplgevyldgid
iasvpeglnlkfdelvqalndsatsrriylsaspncvypdyyldkaiqtqkldflfvqff
yalpciytqglpedlfqamktwtsnvpeskifmalpatpdlngyipprvlnkeilpavtq
asnfagvmifdryfdrfrkysskikr

SCOPe Domain Coordinates for d4b15a_:

Click to download the PDB-style file with coordinates for d4b15a_.
(The format of our PDB-style files is described here.)

Timeline for d4b15a_: