Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (30 species) not a true protein |
Species Tamarindus indica [TaxId:58860] [197290] (2 PDB entries) |
Domain d4b15a_: 4b15 A: [197292] automated match to d1kqza_ complexed with act, mpd, na |
PDB Entry: 4b15 (more details), 1.49 Å
SCOPe Domain Sequences for d4b15a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b15a_ c.1.8.0 (A:) automated matches {Tamarindus indica [TaxId: 58860]} ggnivvywgqggsdnsegslkeacksghynmivleelitydngrdpdlnlgahcvnctsl qqeikycqlklikillqigqvtptkedtkdttkdlsqyldsnffsgksgplgevyldgid iasvpeglnlkfdelvqalndsatsrriylsaspncvypdyyldkaiqtqkldflfvqff yalpciytqglpedlfqamktwtsnvpeskifmalpatpdlngyipprvlnkeilpavtq asnfagvmifdryfdrfrkysskikr
Timeline for d4b15a_: