SCOP 1.57: Domain d1wioa1: 1wio A:1-97

Lineage for d1wioa1 (1wio A:1-97)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein N-terminal domain of CD4 [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)

8. Domain d1wioa1: 1wio A:1-97 [19728]
   Other proteins in same PDB: d1wioa3, d1wioa4, d1wiob3, d1wiob4

Details for d1wioa1

PDB Entry: 1wio, 3.9 Å

PDB Description: structure of t-cell surface glycoprotein cd4, tetragonal crystal form

SCOP Domain Sequences for d1wioa1:

Sequence; same for both SEQRES and ATOM records:

>d1wioa1 b.1.1.1 (A:1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1wioa1:

• d1wioa1 first appeared (with stable ids) in SCOP 1.55
  
• d1wioa1 appears in SCOP 1.59
  
• d1wioa1 appears in the current release, SCOPe 2.08