SCOPe 2.01: Domain d1cdia1: 1cdi A:0-97

Lineage for d1cdia1 (1cdi A:0-97)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (26 PDB entries)

8. Domain d1cdia1: 1cdi A:0-97 [19727]
   Other proteins in same PDB: d1cdia2
   domain 1

Details for d1cdia1

PDB Entry: 1cdi, 2.9 Å

PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices

PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOPe Domain Sequences for d1cdia1:

Sequence; same for both SEQRES and ATOM records:

>d1cdia1 b.1.1.1 (A:0-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
slwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1cdia1:

• d1cdia1 first appeared (with stable ids) in SCOP 1.55, called d1cdi_1
  
• d1cdia1 appears in SCOP 1.75
  
• d1cdia1 appears in SCOPe 2.02
  
• d1cdia1 appears in the current release, SCOPe 2.08