Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein N-terminal domain of CD4 [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries) |
Domain d1cdi_1: 1cdi 0-97 [19727] Other proteins in same PDB: d1cdi_2 |
PDB Entry: 1cdi (more details), 2.9 Å
SCOP Domain Sequences for d1cdi_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdi_1 b.1.1.1 (0-97) N-terminal domain of CD4 {Human (Homo sapiens)} tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr slwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1cdi_1: