Lineage for d1cdi_1 (1cdi 0-97)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein CD4 [48737] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48738] (12 PDB entries) 
Domain d1cdi_1: 1cdi 0-97 [19727]
Other proteins in same PDB: d1cdi_2
Details for d1cdi_1
PDB Entry: 1cdi (more details), 2.9 Å
PDB Description: structures of an hiv and mhc binding fragment from human cd4 as refined in two crystal lattices
SCOP Domain Sequences for d1cdi_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdi_1 b.1.1.1 (0-97) CD4 {Human (Homo sapiens)}
tkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
slwdqgnfpliiknlkiedsdtyicevedqkeevqllv
SCOP Domain Coordinates for d1cdi_1:
Click to download the PDB-style file with coordinates for d1cdi_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cdi_1:
- d1cdi_1 appears in SCOP 1.57
- d1cdi_1 appears in the current release, SCOPe 2.08, called d1cdia1
View in 3D
