SCOP 1.69: Domain d1g9nc1: 1g9n C:1-97

Lineage for d1g9nc1 (1g9n C:1-97)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
Protein CD4 V-set domains [48737] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries)
Domain d1g9nc1: 1g9n C:1-97 [19726]
Other proteins in same PDB: d1g9nc2, d1g9ng_, d1g9nh1, d1g9nh2, d1g9nl1, d1g9nl2
domain 1

Details for d1g9nc1

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9nc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1g9nc1:

Click to download the PDB-style file with coordinates for d1g9nc1.
(The format of our PDB-style files is described here.)

Timeline for d1g9nc1: