Lineage for d1g9nc1 (1g9n C:1-97)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288410Protein N-terminal domain of CD4 [48737] (2 species)
  7. 288411Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)
  8. 288419Domain d1g9nc1: 1g9n C:1-97 [19726]
    Other proteins in same PDB: d1g9nc2, d1g9ng_, d1g9nh1, d1g9nh2, d1g9nl1, d1g9nl2
    complexed with nag; mutant

Details for d1g9nc1

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9nc1 b.1.1.1 (C:1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1g9nc1:

Click to download the PDB-style file with coordinates for d1g9nc1.
(The format of our PDB-style files is described here.)

Timeline for d1g9nc1: